PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000179.1.g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 1061aa    MW: 120533 Da    PI: 8.9656
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000179.1.g00008.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR179.65.6e-25256364191
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................tekerrtraetrtg 61 
                                     +fY+eYAk++GF  ++++s++s+ +g++++++f Cs++g++ e+++                   ++  r +++ ++t+
  FANhyb_rscf00000179.1.g00008.1 256 SFYKEYAKSMGFAAVIKASRRSRASGKFIDAKFACSRYGTKPETSQPetaepvshsressiclkrKRGGRASQSLEKTD 334
                                     5***************************************999888899*************9877778889******* PP

                            FAR1  62 CkaklkvkkekdgkwevtkleleHnHelap 91 
                                     Cka+++vk+++dg+w v +l +eHnH+++p
  FANhyb_rscf00000179.1.g00008.1 335 CKACMHVKRRQDGRWTVCTLIKEHNHDIFP 364
                                     **************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.7E-23256364IPR004330FAR1 DNA binding domain
PfamPF105511.1E-30491583IPR018289MULE transposase domain
PROSITE profilePS509669.198771807IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-4780803IPR007527Zinc finger, SWIM-type
SMARTSM005750.001782809IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1061 aa     Download sequence    Send to blast
MVGQGSPLAA LDRSQQALGR LWRVNGAPSR SLGGSQQPLD GSRRPLKWSL RKFGRVKAGA  60
HWRPLDESQR PLGWSRPPSG SRLSLRRSWR VKVAPSTTLN GSHNPLASQS GSLAALGGLR  120
SPLSGPKRSR QPFGRNFDFD FLFGCVKVSI FCFKKVLVLA MGIDLEQPSG EFHQADNGPG  180
GNSHMVDGRE ENTSGDRVIV TVTNVPVNDR EIAGKNGSVS NFKNRVDARD EINLNAPKNL  240
ELHDGLEFES KEEAFSFYKE YAKSMGFAAV IKASRRSRAS GKFIDAKFAC SRYGTKPETS  300
QPETAEPVSH SRESSICLKR KRGGRASQSL EKTDCKACMH VKRRQDGRWT VCTLIKEHNH  360
DIFPDEAYYF RGHRKLDISS GNVGGNVGGN VDGLNAIRRR TKNLFANMSR QSGGYKKSTN  420
PKGGGKNQSP SVQHLSLEEG DAQVMLDHFL CMQDENPNFF YAIDLNEEQR LRNVFWVDAK  480
GRLDYEIFSD VVFLDTTYIK NEYKLPFAPF IGVNHHLQFI LLGCALLADE SKSTYVWLMR  540
AWSKAMDGHA PRVILTDQDK FLKEAVAEVF PDSRHCFCLW HILGKIPEKL GYVTRQHDQF  600
MENFNECIFK SWTIEQVEIR WFKMVDRFNL RNDIWLQSLF EDRRQWIPAF MRGIFLAGMS  660
TTQRSESLNC FFDKYMQRKT TLKEFLEQYN TILCEKYEEE AKADFETWHK QPALKSPSPF  720
GKQMATLYTH VVFKKFQVEV LGVVACHPKK EAEDGAIKTF RVQDFEEDHH FIVEWNEMTS  780
DISCLCHSFE FNGFLCRHVM IVLQISGVHN IPSQYILKRW TKDAKSRQTR GVGSSSVKSR  840
VQLYNDLCRR AFELGDEGSL SQESYNIAFV ALEEALRNCE NMINSIQRVI HPVSPETHGS  900
HSFEGVNQGN STNKMNKKNS TSKKGQVHSE PEVLTIEMQE SWQGLEQLSS SATTLDGYIG  960
PQQLVQVMGP LNTISSRREN YYSNQHMQGP GQLNSITHIQ DAQYINQQRL HGVGQFHFRP  1020
QTIPNFVIED DLQDMDQSTV GRTQIHGLAS KHLHSKHPSR Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18190RLSLRRSWRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293778.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011460505.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011460506.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
TrEMBLM5WQ400.0M5WQ40_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g01470.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein